SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4959.Q6BPF0 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4959.Q6BPF0
Domain Number 1 Region: 120-221
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.57e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0061
Further Details:      
 
Weak hits

Sequence:  4959.Q6BPF0
Domain Number - Region: 61-134
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 0.0051
Family Gametocyte protein Pfg27 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 4959.Q6BPF0
Sequence length 360
Comment (Debaryomyces hansenii)
Sequence
MVSTHNRDKPWDTEDIDKWSIEEFKPEDNASGLHFTEESSFMTLFPKYREQYLRTIWSDV
TRNLDKYFIDCQLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD
IACDVIKIGNFVTNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
KEVRRVVEDCMNNVHPIYYIKELMIKQELAKNPELAHEDWSRFLPMFRKRNVARKKSKKI
GEKKEKKVYTPFPPAQLPRKVDLQIESGEYFLGKKEKERKKLQEKRDKQEEATEVKKQER
LKDFEAPEENSYENKLVTKEKSHKKDKKDKKDKKEKKDKKRSKHNDDDEEGSSSKKSRHD
Download sequence
Identical sequences Q6BPF0
gnl|GLV|DEHA2E14146g 4959.Q6BPF0 XP_459920.1.41535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]