SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 4959.Q6BSP4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  4959.Q6BSP4
Domain Number 1 Region: 162-296
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.85e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000624
Further Details:      
 
Domain Number 2 Region: 304-336
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000262
Family Retrovirus zinc finger-like domains 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 4959.Q6BSP4
Sequence length 518
Comment (Debaryomyces hansenii)
Sequence
MSAYSRRYTDGPSNYGQDVRGRSEKKVEASHTTKWSGTPSRHKKIGKEDFDTIVTGHLTQ
EQMDAYQQYFRIEEISDILRMASESQSEVLSLLPSGNIANNPNYEREPSPPPKYDAAGNR
SNTREARTKLALEKERHYLVEVAAGSIKNYMSPIDYRKPVKTYEKIYIPVKDYPDINFVG
LLLGPRGNTLRQLQEDSGARLAIRGKGSVKDGKSTSSNNDDDDSNSSLSFSNPNLNSSGN
DDLHVVITSDSQSKIAKAIKLTNQVIEKAISSPVGQNDLKRGQLRELAILNGTLRETKPY
NPETQQSRRSRPGLDVSQLVCKSCGKVGHFARDCKFRGTSDGNNNPIVQDQADSYQQTAP
YSDSRRQREEEDPRNNGREEILPPWKKKKPNVPLPPWQKPQQPLPSTDAPPPPVGLAPPP
SSLAPPPPPPSSLAPPPPPPPSSLAPPPPPSSDIAPPPPSSDRAPPPPPSGIAPPPPPSG
IAPPPPKSPNGVAPPPPPANDAPPAPSSTKNPPPPPPA
Download sequence
Identical sequences Q6BSP4
XP_002770275.1.41535 4959.Q6BSP4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]