SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 498214.CLK_1991 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  498214.CLK_1991
Domain Number 1 Region: 19-245
Classification Level Classification E-value
Superfamily CorA soluble domain-like 1.24e-35
Family CorA soluble domain-like 0.00021
Further Details:      
 
Domain Number 2 Region: 246-309
Classification Level Classification E-value
Superfamily Magnesium transport protein CorA, transmembrane region 5.62e-19
Family Magnesium transport protein CorA, transmembrane region 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 498214.CLK_1991
Sequence length 311
Comment (Clostridium botulinum A3 Loch Maree)
Sequence
MIIFDLLNNFQEVKGDFKAGKSYYWIVIHSQDLNVLKYKLNLKEENIRECENYTQGAQIN
FYKDYVFIILNLLQYDKVVEANEINIFLSKDYIITVYKEKLSLIEEILDDIKECKNCFLI
KENPKPFILLYYIIDRIIIKNYEVIATLETEADKIEIDILKEPRHEHIDEIIYLRRQVYR
IKKYITPLRYIGDSLISNDNGMIEKECIKYCMTLNNKIEKLMVALETLVQDLSLVREAFE
SEISNKTNELMKVFTLIATIFLPASLITGIYGMNFDNLPPMKNPYGHLYVLGFTLIISLF
LVYLFIRKKWL
Download sequence
Identical sequences B1KXR6
498214.CLK_1991 gi|170761790|ref|YP_001787924.1| WP_012344965.1.9908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]