SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 498214.CLK_3296 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  498214.CLK_3296
Domain Number 1 Region: 3-155
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-42
Family GHMP Kinase, N-terminal domain 0.0000705
Further Details:      
 
Domain Number 2 Region: 159-279
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 5.18e-27
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 498214.CLK_3296
Sequence length 280
Comment (Clostridium botulinum A3 Loch Maree)
Sequence
MLSKAHAKVNLSLDVIGKRKDGYHLLKMLMQTIDLYDLIQIKKIKKGIIIDCDREYIPKD
RRNLAYKAAELFLDRYNIDSGVRIDITKNIPVAAGLAGGSTDAATVLKIMRDIFRSDISN
KELKEIALDIGADVPFCIEGGTALCEGIGEKITPIKNFKNQILVLVKPNFGLSTKDVYNN
LKVEKIYIHPNTTKLIQSIEEDNLKSVARNMRNVLENVTLRKYKTLNSIKSNFIELGALG
SMMSGSGPSVFGLFDDMLKAQICYDNMKEKYKEVFITRTI
Download sequence
Identical sequences B1KSP3
gi|170758380|ref|YP_001785450.1| WP_012341966.1.9908 498214.CLK_3296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]