SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 498214.CLK_A0328 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  498214.CLK_A0328
Domain Number 1 Region: 31-84
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 0.000000791
Family Adenylation domain of NAD+-dependent DNA ligase 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 498214.CLK_A0328
Sequence length 125
Comment (Clostridium botulinum A3 Loch Maree)
Sequence
MFQQSNLFDLLDTSKNITEEKQVNKNNTHENEIIELINKRRRQILVHSCIYYRLNDNLID
DYTYNEWARELENLQNMYPDLLENCIYKEDFKKYSSATGYDFKSLGDPKILNRAIKLLRF
SNQNI
Download sequence
Identical sequences B1L367
gi|169834756|ref|YP_001715955.1| WP_012300819.1.9908 gi|169834756|ref|YP_001715955.1|NC_010418 498214.CLK_A0328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]