SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 498217.ETAE_0409 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  498217.ETAE_0409
Domain Number 1 Region: 5-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.54e-50
Family Ribonuclease PH domain 1-like 0.0000143
Further Details:      
 
Domain Number 2 Region: 293-488
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.83e-46
Family Ribonuclease PH domain 1-like 0.0000132
Further Details:      
 
Domain Number 3 Region: 145-235
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.93e-31
Family Ribonuclease PH domain 2-like 0.001
Further Details:      
 
Domain Number 4 Region: 450-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.75e-28
Family Ribonuclease PH domain 2-like 0.0000859
Further Details:      
 
Domain Number 5 Region: 608-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.91e-22
Family Cold shock DNA-binding domain-like 0.0000296
Further Details:      
 
Domain Number 6 Region: 239-320
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 6.8e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0024
Further Details:      
 
Domain Number 7 Region: 554-622
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.15e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 498217.ETAE_0409
Sequence length 707
Comment (Edwardsiella tarda EIB202)
Sequence
MLTPTVRKFQYGQHTVTLETGMMARQATAAVMVTMDDTAVFVTVVGAKKAREGQDFFPLT
VNYQERAYAAGRFPGGFFRREGRPGEGETLTARLIDRPIRPLFPEGFLNEVQVVATVVSV
NPQVSPDIVAMIGASAALSLSGIPFNGPIGAARVGYINDQYVLNPTMDELKQSRLDLVVA
GTDNAVLMVESEADLLSEDQMLGAVVFGHDQQQVVIENIKALAAEVGKPRWEWHAPEVNV
ALQHRVAEMAEARLGEAYHITEKQARYAKVDEIKESVIVDLLAEDDALDAGEISDILGAL
EKAVVRGRVLRGEPRIDGREKDMIRALDVRTGVLPRTHGSALFTRGETQALVTATLGTER
DAQNIDELTGERTDRFLLHYNFPPYSVGETGMMGSPKRREIGHGRLAKRGVLAVMPSQDA
FPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEQDNFVVLSD
ILGDEDHLGDMDFKVAGSRDGVTALQMDIKIEGITREIMQVALNQAKGARLHILGVMEQA
INAPRGDISEFAPRIHTIKINPEKIKDVIGKGGSVIRALTEETGTTIEIEDDGTVKIAAT
DGDKAKHAIRRIEEITAEIEVGRIYQGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVE
KVTDYLQMGQEVAVKVLEVDRQGRVRLSIKEANASAAAGQDAPADAE
Download sequence
Identical sequences A0A0H3DMG0 D0ZB78
498217.ETAE_0409 gi|269137767|ref|YP_003294467.1| WP_012847282.1.32191 WP_012847282.1.83294 WP_012847282.1.91532 WP_012847282.1.93598 gi|387866511|ref|YP_005697980.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]