SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 498761.HM1_2322 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  498761.HM1_2322
Domain Number 1 Region: 5-141
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.6e-52
Family Ribonuclease PH domain 1-like 0.00000939
Further Details:      
 
Domain Number 2 Region: 290-484
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.86e-49
Family Ribonuclease PH domain 1-like 0.00000762
Further Details:      
 
Domain Number 3 Region: 142-232
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.49e-30
Family Ribonuclease PH domain 2-like 0.0015
Further Details:      
 
Domain Number 4 Region: 446-544
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.32e-28
Family Ribonuclease PH domain 2-like 0.0000959
Further Details:      
 
Domain Number 5 Region: 550-636
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.82e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Domain Number 6 Region: 616-691
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.86e-22
Family Cold shock DNA-binding domain-like 0.00019
Further Details:      
 
Domain Number 7 Region: 236-316
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 8.37e-18
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 498761.HM1_2322
Sequence length 709
Comment (Heliobacterium modesticaldum Ice1)
Sequence
MQVFSMEIAGRTLTIETGRVAKQAGGSVLARYGDTVVLVTATGSKEPRPGIDFFPLTVDY
EERLYAVGKIPGGFIKREGRPTEKAILSARLIDRPIRPLFPKGFRNDVQVVATVMSVDQD
CPPDIVGMIGASCALSLSDIPFEGPIGGVLVGRVDGKLLINPTMEQAEKSDMHLVVAGTK
DAVMMVEAGANEVPEEDMIEAIMFGHQEIQRIVAFQEEMVAVAGKPKREVPLKQINPELE
QAVREYVGDKLRNAIQNPDKLSREADIQAVMKETVEALLPHFPEEEKDIRTVLDTMEKEI
VRKLITVDKQRPDGRKMDEIRPISVEVGILPRTHGSGLFTRGQTQVLNVCTLGTIADLQI
LDGLGVEESKRYMHHYNFPPYSVGETRPMRGPGRREIGHGALAERALLPVIPSEDEFPYT
IRLVSEAVESNGSTSMASVCGSTLSLMNAGVPIKKPVAGIAMGLIKEGEHFSILSDIQGM
EDHLGDMDFKVAGTADGVTALQMDIKIKGVNREILTQALQQARKGRLFILDKMLAVIDKP
AAEMSPYAPRIITMSIDPDKIREVIGPGGKVINKIIAETGVKIDIEDDGRIFIAATDTEA
ANKAVRIIESITADVEVGKVYTGKVTRIMNFGAFVEVLPGKEGLIHISQLAEERVAKVED
VVKIGDEVTVKVVEIDKQGRINLSRKEVLKANKPAVTGGARPDEMRRRF
Download sequence
Identical sequences B0THS2
498761.HM1_2322 gi|167630367|ref|YP_001680866.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]