SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 500485.B6H1Z8 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  500485.B6H1Z8
Domain Number 1 Region: 43-210
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.0000801
Family CAT-like 0.014
Further Details:      
 
Weak hits

Sequence:  500485.B6H1Z8
Domain Number - Region: 262-343
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0215
Family Calponin-homology domain, CH-domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 500485.B6H1Z8
Sequence length 516
Comment (Penicillium chrysogenum Wisconsin 54-1255)
Sequence
MHRVPRLTRPIYIRSIQSTVIQRSRLSQRTQPSRKLDSAKMFQPYNLTPLDQLSPPGHFT
MSLTFNLVGKNRVEALQRMEDAGSCVFSKFPFLSGMVVPSTQRDGKSNALQVRPSTAAEL
EECPIIVTQHHTEPTAITVDGKFNTSLMPFPVVSPPRNPSPVLRLKAHVIEDNVHLVLCF
DHRVMDGSGIFALFRTFSSFCRDLNATGPFTTTQAQEEIRQHIEQVASTATPRDVQWTSL
PTTTSEDKVPTDYGRVPIGSSHVFDAQKINILLDACNSTLQSLPEKYRKDLSETSLRPGL
LVSALLGICSNRARLRAFPDEPHLSSDMFIVENLRKALNLRRGYLGSTIGATQVKCDGYA
HPPPESLQNIHVPESLSPVGAEDMWRVCNVAQSLQEVSGRLDKEYTEGIIARMSREQDWS
SFRPGWGVNFLVSDIKSAKPYGNFGPLGDLELFDLHFDTQPGYCWIMPNLPSDTASPYPC
WRLRWILERAAMECLSNDPLFQWASTPSTASTHAEV
Download sequence
Identical sequences B6H1Z8
XP_002558784.1.37043 500485.B6H1Z8 Pchr_Wisconsin_54-1255:Pc13g03470.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]