SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 500485.B6HBS4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  500485.B6HBS4
Domain Number 1 Region: 275-354
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00081
Further Details:      
 
Domain Number 2 Region: 127-213
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.7e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 3 Region: 47-112
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000886
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 500485.B6HBS4
Sequence length 366
Comment (Penicillium chrysogenum Wisconsin 54-1255)
Sequence
MDSAEIHQTTAVDHDEPMTDNFNDNLADQGDLEAPLKTEEEYAIADLTLRAIVSSKEAGV
IIGKAGKNVADLRDETGVKAGVSKVVPGVHDRVLTVTGQLRSLARAYAIVAKGLLEGAPQ
MGMGGIVSNNGTHPVRLLISHNQMGTIIGRQGLKIKHIQDASGVRMVAQKEMLPQSTERI
VEVQGTPEGIEKAIWEIGKCLLDDWQRGTGTVLYNPAVRASLSGSQPLNNNPPAGNGYQN
NTSSRQYNRTGNGADFSDGGYNRRSNSDAGNRGYPLVTEDGEEIQTQNISIPADMVGCII
GRGGTKITEIRRSSGARISIAKAPHDETGERMFTIMGSAQANEKALYLLYENLEAEKTRR
SQLPQE
Download sequence
Identical sequences A0A167WXF8 B6HBS4
XP_002562313.1.37043 jgi|Pench1|26360|fgenesh1_pg.3_#_1378 500485.B6HBS4 Pchr_Wisconsin_54-1255:Pc18g04820.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]