SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 500485.B6HHE2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  500485.B6HHE2
Domain Number 1 Region: 4-241
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.17e-34
Family Extended AAA-ATPase domain 0.000000933
Further Details:      
 
Domain Number 2 Region: 249-343
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 1.7e-33
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 500485.B6HHE2
Sequence length 352
Comment (Penicillium chrysogenum Wisconsin 54-1255)
Sequence
MALLVDKLRPRTLDALSYHPELSDRLRSLAHSGDFPHLLVYGPSGAGKKTRVIATLKELY
GPGVEKIKIDARVFQTTSNRKLEFNIVSSVYHLEITPADVGTYDRVVVQELLKEVAQTQQ
VDLSAKQRFKVVVINEADHLTRDAQAALRRTMEKYSPNLRLILLANSTSNIIAPIRSRTL
LVRVAAPTESDICSALHLAGKKEGWTESEVLNKRIAKESGRNLRRALLMFESIYAQNEKV
TDKTPIPPPDWEALVTLTADEILAERSPARLLHVRARLYDLLTHCIPPTTILKTLTFKLV
ARVDDALKPDVIKWSAFYEHRIKLGSKVIFHLEAFVAKFMRIYESYLMGMDF
Download sequence
Identical sequences A0A167RRL4 B6HHE2
500485.B6HHE2 Pchr_Wisconsin_54-1255:Pc20g14580.t1 XP_002563934.1.37043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]