SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 500485.B6HMK3 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  500485.B6HMK3
Domain Number 1 Region: 150-214
Classification Level Classification E-value
Superfamily SNARE fusion complex 9.94e-20
Family SNARE fusion complex 0.00099
Further Details:      
 
Domain Number 2 Region: 9-146
Classification Level Classification E-value
Superfamily SNARE-like 0.000000000000165
Family Synatpobrevin N-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 500485.B6HMK3
Sequence length 248
Comment (Penicillium chrysogenum Wisconsin 54-1255)
Sequence
MASSSKTSSSCIAHRTTILAEHSSPGSSSTAASSLASIILPKITHDKPQKLTFTHERLFV
HYIADSPTGSQSEDGNIAEPNSHAPLSFVVVASAEQGRRIPFAYLLEMKRKFLTTYEPST
TEFASLPAYGCAAFNNELRSLLQAYNTAPPADSLASARREIDSVRDIMTENIERVLERGE
RIDLLVDKTDRLGGSAHDFRIRSRGLRRRMWWKNTKLMIMMVVVVIFLLYLFIGMGCGLP
AWGECVGH
Download sequence
Identical sequences B6HMK3
XP_002569160.1.37043 Pchr_Wisconsin_54-1255:Pc21g21890.t1 500485.B6HMK3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]