SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 502025.Hoch_0114 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  502025.Hoch_0114
Domain Number 1 Region: 319-453
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.14e-28
Family HD domain 0.012
Further Details:      
 
Domain Number 2 Region: 208-304
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000136
Family Eukaryotic type KH-domain (KH-domain type I) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 502025.Hoch_0114
Sequence length 520
Comment (Haliangium ochraceum DSM 14365)
Sequence
MQFLYVILAILGGITVGVGIARLAGIGRNAAAERAAEAEARRIITAAEAEVEEIKKAAEV
EGKELAFRLKADVEEGTRKRRAELVQQEEALLAREREMERKQKDARRLEGELEKRERSID
GRAKAAEAMARKAEASQDKAKAMLEEIAALTAEQARERLEDQIREQAREAAAAEVKLIEE
NAAKEADSRAKEIVATAIQRYASELVQERTVSVIPLPSDDMKGRLIGREGRNIRALEAAT
GIDMIIDDTSEVITISCFNPVRREIARLAISKLVADGRIHPTRIEEVVKKAEAEIERTCK
EAGEQAVFDLGLHRVSPELIVQLGRLKYRASYAQNLLMHSVEVGFLAGLMAAEVGLNVKQ
ARRAGLLHDIGKSVDHELEGSHAQVGAQMARKFGESAKICQAIAAHHGDPEPSSVLDHIV
DAANRLSSARPGARRELLASYVQRLEKLEHICNGFGGVTKSFALQAGREVRVMVENDKVD
DAQALMLSKDIARKIETEATYPGQIRVVVVRETRASDYAR
Download sequence
Identical sequences D0LGK9
gi|262193439|ref|YP_003264648.1| WP_012825382.1.83622 502025.Hoch_0114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]