SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 502025.Hoch_1609 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  502025.Hoch_1609
Domain Number 1 Region: 123-172
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000194
Family Fibrinogen C-terminal domain-like 0.0039
Further Details:      
 
Weak hits

Sequence:  502025.Hoch_1609
Domain Number - Region: 101-133
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.0777
Family Blood coagulation inhibitor (disintegrin) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 502025.Hoch_1609
Sequence length 302
Comment (Haliangium ochraceum DSM 14365)
Sequence
MCPWAIRISEYGTLRCRAQGPTETDVDCGGTCPPCTDGLTCEGGEDCLSQVCSAGACAVA
ECGDGVVIAGGEECDDGGPSATCNADCTAPRCGDGTTNPAAGEQCDDGNNNDEDGCLQDC
TLDIQISCAAPLAAAPSTPSGFYDIDPDLDGPAPVRNVYCDMEHEGGGWTNLDFTAGIVY
LENGNFANCTQGLSSTDNAINCQFPHVNGDAGRWMYHFNCDGSDDTAAYILDHMAPIIGH
QSSLNIGGWASLSQRHINESSLDDQEFCYVDGQWVHYTAPSCQVYSDNRNGNCAINEFII
NR
Download sequence
Identical sequences D0LWR2
gi|262194843|ref|YP_003266052.1| WP_012826767.1.83622 502025.Hoch_1609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]