SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 502025.Hoch_3847 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  502025.Hoch_3847
Domain Number 1 Region: 306-498
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.27e-47
Family Ribonuclease PH domain 1-like 0.0000221
Further Details:      
 
Domain Number 2 Region: 3-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.49e-44
Family Ribonuclease PH domain 1-like 0.0000277
Further Details:      
 
Domain Number 3 Region: 456-554
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.31e-27
Family Ribonuclease PH domain 2-like 0.0000942
Further Details:      
 
Domain Number 4 Region: 144-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.49e-27
Family Ribonuclease PH domain 2-like 0.0018
Further Details:      
 
Domain Number 5 Region: 561-646
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.72e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 
Domain Number 6 Region: 626-700
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.34e-19
Family Cold shock DNA-binding domain-like 0.00034
Further Details:      
 
Domain Number 7 Region: 238-326
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.000000000018
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 502025.Hoch_3847
Sequence length 711
Comment (Haliangium ochraceum DSM 14365)
Sequence
MRFVRESVTVGDKEIIIETGKWAKQASGSVVVRCGDTMVLVTATASKSPRVGMDFLPLTC
EYQEKTYSAGKIPGNFFRREARPSTDEVLVARLMDRPSRPLFPKLWRCETQLIANVVSFD
QSNAADVLAMTGSSCALHISDIPWDGPVAAVRVGRVAGEFVAFPTFEEREQSDIDMIVSA
SRDAIVMVEGGMREVPEQVLIDALLFAHEAVQPLIDLQEKLRAAVGKEKRPFEAPSFDQD
LLAKVQESAWERVREAFEVREKHSRSAALSDVRRALVGELCGAQENATEAVYAGREDEVS
EAYEKVKKRFARLNTLDSKHRIDGRAYDEIRAISCEVGILPSAHGSALFTRGETQALVSA
TMGTRYDEQKLDTLLGGMQKPFFLHYNFPPFCTGEAKPIRSTSRRELGHGNLAERSIAQV
MPEREDFPYTVRVVSEILESNGSSSMASVCGASLSLMDAGVPVLSPVAGIAMGLMMEGER
YAILSDILGDEDHMGDMDFKVTGTARGVCALQMDIKLKGLTRDILVEALEQARRGRMHIL
DKMAEALQTPREDLSPNAPRIVTETVKPDKIRDIIGPGGKTIRAIAEQTGAKIDVSDAGV
VSIASSDSRSLQQAIDIIRGLTMEPEVGQFYGGVVKRIVEFGAFVEILPGTDGLVHISEL
SSERVRRVEDVIQEGEEIVVKCISVDRDGKIRLSLKEAADANPDDILHFVA
Download sequence
Identical sequences D0LZ84
502025.Hoch_3847 gi|262197030|ref|YP_003268239.1| WP_012828945.1.83622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]