SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 502800.YPK_3147 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  502800.YPK_3147
Domain Number 1 Region: 434-514
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 0.00000126
Family Protein prenylyltransferase 0.012
Further Details:      
 
Weak hits

Sequence:  502800.YPK_3147
Domain Number - Region: 792-864
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.045
Family Calponin-homology domain, CH-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 502800.YPK_3147
Sequence length 1090
Comment (Yersinia pseudotuberculosis YPIII)
Sequence
MEKQIHTGSGDNVANNKIVNIINSIEPKDIKGFIADFMQDISHRKISDAEKKIDSITNID
GLDGNVKSILNALKIKADLIREKKGLRKQELQNLVRNKTLDYDVLDVTLSILLHFESKIQ
LDSARDRYFSAERIGQYSNEIFFEYLSTDDEIVESFNNQDKFNFLEHEVLGLIRGSLRNN
NINIAYDLSKHLNANYPSINSTFFLLHCETLLLLNNTKNRHILSFNRHEKNHADILIDSL
LDNFSSDASRFILPLINQLYITGFTNTKLVDLAKKNIIEIKKISSECADIITKITNKTVL
PYSQLTLPQEIKDLETFSTLDELLTIGSFNKTSLADWRYSGGKISTDDSYINSLLELQVS
VWLCTSQDKNSIMDLTQQAEEFLSLDINRYKELNPSNLIFLCERFMALNLSLIAVKYLDP
ILPDEPWLSPLLENLLQALYLSEQNDLFFKKLALFSDDVKSESIWLLEAQVYERLQQDDK
AITAVQEAIKIDNKNAYSWDLLLYLRQKKKTNKDDLTKLVVEIPSEVFYTYHETKIPLLN
SIAKYVDPNIAESVLVDWFVVNPNQLAKHLIDIHHNSLINRTDKQDVVYLPKYCIKGIEY
NDGFRKNKRILIKDVVTEHPLFLNINSPLGKIVEKLTIGETVEDPYLGEISLTDEIPAPV
AAYQAAIKIRDQINDGSDSFKLFELPSNEDDFLPYFEKILRRFSGNKAAQNPVLQNPNIP
LCMRGNFTHHGDYFRAAYYHLTSIETTQYINLHNEGIKDPDKIIVDTYTSIYLSLLGFVP
LIEKKGTTLILTNYTKDILESWIRDITREDYLSLDVTKFGMQRITAEDIRNNAYDFIQQL
KLLIDISQEEKINVVDTPENLVKIKDIIDPSVFSTIQLSHANNIPWLSIDHLLCILAQKS
DFPVVNSYNFLNMLINSSDFKERKESIIVSLTCGLPVPIFYSDIIILSRSNENKDIYLTA
KFIEKHKSPSNDTLENINYLSQIMRNVIVKAYLDRDILKGSRAYNPIYDGYEEYVFNVCC
QTALLCLEGKTAEARMALLISETLEPFYQSRSLRKLVCDLATSFSTGHFLSIEAINIELE
RIISSKNITA
Download sequence
Identical sequences A0A0H3B790 A0A2A7VPK7
WP_012304478.1.20547 WP_012304478.1.42976 WP_012304478.1.52792 WP_012304478.1.99882 502800.YPK_3147 gi|170025366|ref|YP_001721871.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]