SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 504832.OCAR_4503 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  504832.OCAR_4503
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.83e-51
Family Ribonuclease PH domain 1-like 0.0000208
Further Details:      
 
Domain Number 2 Region: 294-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-50
Family Ribonuclease PH domain 1-like 0.0000097
Further Details:      
 
Domain Number 3 Region: 145-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.57e-28
Family Ribonuclease PH domain 2-like 0.001
Further Details:      
 
Domain Number 4 Region: 451-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.93e-27
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.96e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 6 Region: 621-703
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.58e-22
Family Cold shock DNA-binding domain-like 0.00053
Further Details:      
 
Domain Number 7 Region: 237-322
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.12e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 504832.OCAR_4503
Sequence length 714
Comment (Oligotropha carboxidovorans OM5)
Sequence
MFNTHSVELDWGGRPLKLETGKVARQADGAVIATYGETVVMATVVSAKTPKEGIDFLPLT
VNYQEKTYAAGRIPGGYFKREGRPSEKETLVSRLIDRPIRPLFADGYRCDTQVIVTTLSH
DMENDPDIVAMVAASAALTLSGVPFMGPVGAARVAFVNNEFILNPTLDEMVDTQLDLVVA
GTATAVLMVESEAKELPEEIMLGAVMFGHKHFQPVLKAIIELAEQAAKEPRDVVATVNAD
LEKEILGIVEQDLRKAYSIPVKQDRYAAVGAAKDKVLEHFFPEGIEPRYEKLRVLDVFKD
LEAKIVRWNILDTGRRIDGRDLKTVRPIVAEVGVLPRAHGSALFTRGETQALVVTTLGTG
EDEQYIDSLAGTYKETFLLHYNFPPFSVGETGRIGSPGRREIGHGKLAWRAIHPVLPAHH
EFPYTLRVVSEITESNGSSSMATVCGSSLALMDAGVPLKRPTAGIAMGLILEGDRFAVLS
DILGDEDHLGDMDFKVAGTEKGVTSLQMDIKIAGITEEIMKVALTQAKDGRMHILGEMAK
ALTAARAELGEHAPRIEVLQIPTDKIRDVIGTGGKVIREIVEKTGAKINIEDDGTVKVAS
ANGESIRAAIKWIKSITSEPEVGQIYDGTVVKVMEFGAFVNFFGPKDGLVHISQLAASRV
QKTSDVVKEGDKVKVKLLGLDDRGKVRLSMKAVDQTTGEDLEAKQKAENAPAAE
Download sequence
Identical sequences B6JCR8
504832.OCAR_4503 WP_012561679.1.10663 WP_012561679.1.50963 WP_012561679.1.53695 gi|337739278|ref|YP_004631006.1| gi|386028297|ref|YP_005949072.1| gi|337739278|ref|YP_004631006.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]