SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5057.CADACLAP00004938 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5057.CADACLAP00004938
Domain Number 1 Region: 12-129
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.7e-32
Family Calponin-homology domain, CH-domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5057.CADACLAP00004938
Sequence length 621
Comment (Aspergillus clavatus)
Sequence
MASVTSLDKDLRNLRLSRYTPQAAAEVREWIEETLHERLPAGDLLDALKDGVALCRLVNL
AVSPGVKYKQSSMPFVQMENISHFLRACQIPPLSLPPHDVFLTVDLYESKDPAQVLQCLM
AFSRRANALQPTKFLRTIGVQSKGGTLSPHLTGSSQSATTPRKSRGLSNVSDRSGTSSPA
KSPAAVSSWSKKSDEHATMPAWNIHQYGYMGGASQGNQGVAFGARRQITTPSPLVPSLEE
KERRRREEEERQRTEKEESERLRQQEREAEEAHAKAEEERRWEEETARLKEVERRRLDEE
RQQWDEQQRKWEEEERKRQQDEKEAEEKLDNDRQRRREGADALLTGQFLSQYQAKLSDET
RESQRIKQLERELELAKEREFQYQRERQDVQEKQTPKPRSPRPVPVPPKPSYDLSSLEQE
RRMLRTEWQKHQPHDETAESSSSPPPIPPRALPEPTQSAAGAAPPTPSRPLPDPATYTTK
SQAQNSRVDRFLASNRPPVAPKPATHRPQDYTTTAEVDEENSRRIAAQQKTRAGGWASKS
LLEREMERERERQREWEESQKQTRDAAAKGLSDSKLGVGPGQGAWDVHQYGFMGGDNQNR
GGPGLGVGGARRQIIGPRPPR
Download sequence
Identical sequences A1CIP5
XP_001272176.1.35617 5057.CADACLAP00004938 ACLA_052220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]