SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5057.CADACLAP00008298 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5057.CADACLAP00008298
Domain Number 1 Region: 271-350
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.79e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00079
Further Details:      
 
Domain Number 2 Region: 125-208
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.31e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 3 Region: 38-109
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000269
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5057.CADACLAP00008298
Sequence length 362
Comment (Aspergillus clavatus)
Sequence
MDSTEMRDAPPVVDDAMTDAMNVVDEGDMDITPKTEEEYAQSMLTLRAIVSSKEAGVIIG
KAGKNVADLRDETGVKAGVSKVVPGVHDRVLTVTGPLQGTARAYALVAKGLLEGAPQMGM
GGIVNNNGTHPVRLLISHNQMGTIIGRQGLKIKHIQDASGVRMVAQKEMLPQSTERIVEV
QGTPEGIEKAVWEIGKCLIDDWQRGTGTILYNPAVRASVGTGSSINTNTTASNGYNSRPY
NRTGNGADFSDGQSAGYSRRSNPDTSNRGYPLVTEDGEEIQTQNISIPADMVGCIIGRGG
SKITEIRRSSGARISIAKAPHDETGERMFTIMGSAQANEKALYLLYENLEAEKTRRSQLP
QE
Download sequence
Identical sequences A1CF54
5057.CADACLAP00008298 ACLA_092010 XP_001272929.1.35617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]