SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5059.CADAFLAP00002348 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5059.CADAFLAP00002348
Domain Number 1 Region: 687-798,834-888
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.51e-22
Family Calponin-homology domain, CH-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5059.CADAFLAP00002348
Sequence length 1041
Comment (Aspergillus flavus)
Sequence
MPQAAMRCTSNHTINIASPSSYLATHGSNLRLLGEVGTPCPSRFSRFDRGSGGDSSSNKL
WEDSLENCDETANIEFTTEIKAPLLTGVKPRRRTKTGSSFAIHHDGEQNLVQTANPRRRE
TRPAVAPSGRKMSLLAQPAQRFRPKASSTASPPRNSKPLGEPEKRLRNTKLDAQKNRELL
MQINENGRKTPSKNALRTDVRRNTVYIPTDDTTVASLFMGISSPAKSNNVQYYVPEDTRV
NTLESQIARKRQAKRSLASSAQRIPLQPSAKVKQEPCIHVDIAGKNGGKENVPPGTCLLD
KEKGKVSQSMKINDEYENPRTASKPAQTQLRGYPSTKSMNPLAARPVNGTIKRTVTGENR
NNAKTPSVHARGSKVEKRRTNVNRTPSVSKNSTIANTLRNSEMRANPSKDSVVRPKSKHI
DDKYPLVKEDITNPELYEEDWLSHQEIMITQLANGLFDQANESLSFKEPTVLRQELLKLY
QTTSFAHLYKRVQASLLYGAMSIPKDVLVRNDRLQQDVGMKRRFLDFWMQTYDPRALRAA
VETVTGRRMTDNKLDQETSHSHPDMDSGNGRALKRGLENFLNTFLLQNQDMERYAREFSS
SDLEVGTTYHRTVLRSIMIVILLDKGMSSPGTVLPRCLFLRSSQLKSSAAVIQALARFLL
PSSGDITKTLGHLDCQLVYEQSALQEYEYQISNLAVDMRDGVRLTRIVELLLYPTDLSLA
DGERLGPLSQGLKLPCLSRTVKLFNVRIALDALACSKSSYKLVRRIRAEDIVDGHREKTI
ALLWGLVSQWSLAGLVDWYELRKEINRLKQKAVTQYGYELVKDEGWFNGDFEGLYGKSDD
ATSLLRQWASILGCLKGLRLENFSTSFADGKIYESIVDEYESYILKGDQPLSTELKGLPF
SLQSRLRALGCSAQLAYLISPGSSRSHILDSDFTLGALTFLCSRFLSATKRARAATVLQR
RWRQVLANRNLQRRTVARDVARQCAAVVQTRDRILWAKDIIILWWRTLKAKQQRHNSTDS
RYEEQIPMSKGVPLRGQWSPY
Download sequence
Identical sequences B8N1A8
XP_002374483.1.25037 5059.CADAFLAP00002348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]