SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5059.CADAFLAP00002896 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5059.CADAFLAP00002896
Domain Number 1 Region: 388-464
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.94e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00029
Further Details:      
 
Domain Number 2 Region: 105-182
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000927
Family Eukaryotic type KH-domain (KH-domain type I) 0.00081
Further Details:      
 
Domain Number 3 Region: 190-267
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000994
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5059.CADAFLAP00002896
Sequence length 468
Comment (Aspergillus flavus)
Sequence
MSASPSALQSTKRPLEDPSSPSGPNDQPEAKRPALDKVVKGDESEAYAEVKTESSGVPSA
SADGQGDTVVPDAPNAKGTNPETQPIQSTASHAETGSQSEQHRPQDESSWIHIRAVISSQ
EAATVIGKGGENVSQIRRLSGAKCTVSDYSRGAVERILTVSGPQDAVAKAFGLIIRTLNN
EPLDAPSTAQSKTYPLRLLIPHILIGSIIGKGGGRIREIQEASGARLNASDACLPLSTER
SLVILGVADAVHIATYYVAVTLVEQLTERFGGPAASAYATRSGGPAGAVPGGMQVVPYVP
QPAGGQYGHPDTFKRHHPHPNRAAAGAYGVPYLHGQPAPAPVAQPAMHYGGAPQPYAGAG
PHQPAPYGAPQAAPARGGPTPVAPVGGAMPGQPLTQQIYIPNDMVGAIIGKGGAKINEIR
HLSGSVIKINEPQENSNERLVTITGTQECNQMALYMLYSRLESEKHRI
Download sequence
Identical sequences A0A0F0IAB5 A0A1S9DNF5 A0A2G7G8J3 B8N4A8
AFL2T_02683 XP_001819500.2.101437 XP_002375031.1.25037 5059.CADAFLAP00002896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]