SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5059.CADAFLAP00002926 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5059.CADAFLAP00002926
Domain Number 1 Region: 864-955
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000672
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 2 Region: 583-657
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000818
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 3 Region: 757-848
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000307
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Domain Number 4 Region: 650-746
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000114
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 5 Region: 264-333
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000599
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Domain Number 6 Region: 214-280
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000071
Family Eukaryotic type KH-domain (KH-domain type I) 0.01
Further Details:      
 
Weak hits

Sequence:  5059.CADAFLAP00002926
Domain Number - Region: 364-431
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0159
Family Eukaryotic type KH-domain (KH-domain type I) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5059.CADAFLAP00002926
Sequence length 963
Comment (Aspergillus flavus)
Sequence
MASDLSNADVNGGIPKSRAAMLEEQHARDEVHKPTVEDVVDEEDLKHPPPSSSVQDQKVD
APAQSPAPTEVPAPKAAPKKAPAFDVQSEELFPALGSGPKPKAPAASAWGARGPSAAAAV
ANGIPGGSPAAQGPRIMSLPGKHVEQLRLAPSQMLPRGQLKKPLRDILRDISRRSKANVD
MRGGPGGSIIFEGKGSVDAVRQALKEVAQQVGSKPPPQEADPGHVQFVAIPEKHIHISGE
RAAAQEARAEIERLAADLQRQLTLRQLAINRGQHQFILGDNADALHEFLADTGCAIVLPP
ASDDSEFLTITGPLDSIENGINRAMDLATSMQMASIDLSRQHPNAPSGAHAHARALTRYL
RQRQIIKELESMYDARIALPPSSDGPVTWEVYSRDGKNTIRARSDIMNLVHAHPPARLRH
ISVDPYFHPYIRSRAIPKLQEEYGVHVLTPEELDCPDVVLVYEGPSATASQFEVPRQRPT
AAELAAFEKALQEAQEYLSSVLGDQNDIVAKSVTVPAKYQEKVRKFIAREEQAKGEDLIP
VRALVAEPSGRGAECEVALRGPSRLVEELISKLQAFVTEQEKDDLERGYTTSFDFPQKFA
NFLIGKKGENINKLREEFDVDIKVENGKVEVKGPKAKADAAKARIINLGKKLEDETTHIL
KIPAQYHRELIGQQGSQVNRLQDRYHVRVQFPRAAPIVADDQSVEASSEAGGSRPSRPQQ
GADEVIVKGPSKGADATRDELLSLLQWVVDHSHSGSVSVAQSQIPSLIGQRGREMDKLRA
DTGARIDVPGADDTPDASGRVQIKIKGTKKQVEEAKKILEQRSNEFDATVTKTIDIDKKY
HKSLIGGGANDPTQPATIPWVLAGNRDNVAKAKAALEKAIANASQQSATGYLILPDPKTY
RFVVGQGGSQINAIRKQTGCRINVPKDQAKGEAIEVKGNKESLEQAKDMILEAVRAGLEG
NSR
Download sequence
Identical sequences B8N4D8
5059.CADAFLAP00002926 XP_002375061.1.25037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]