SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5059.CADAFLAP00004997 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5059.CADAFLAP00004997
Domain Number 1 Region: 235-340
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.55e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 2 Region: 137-220
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000142
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Weak hits

Sequence:  5059.CADAFLAP00004997
Domain Number - Region: 464-478,520-531
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0175
Family Formin homology 2 domain (FH2 domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5059.CADAFLAP00004997
Sequence length 587
Comment (Aspergillus flavus)
Sequence
MADDERRVKRSRFDQTEPEPRRASRFDRRSRSPSSRQSEATRTRSPLSREPRSPSADPAK
KSGGADPAAAAAAAAAKINAQLQAKKGIQHVDVPPIRSATSPAPAAASPSAGDASTKLNT
DIYVADGDYIKDIEINDLRNRYTLTKGSTQKMIKEETGADVTTRGNYYPDKSMATAANPP
LYLHVTSTNKEGLEKAVDLINELMKKELPNLVDERRFRRREPEQVERDEYGRRKWPEERI
PVDLEPIPGFNLRAQVVGQGGAYVKHIQQRTRCKVQIKGRGSGFMEPSTGRESEEPMFLH
VAGPDPNDVKSAKELCEDLLANVREQYQRFKENPPQHNYGGYGQRGDRYQGGGYGGGYGG
GNGGGSGSGSGGYGNHSHQNSPSTSGSPAAQGATGSSGGQNLADYSAQYAQYYGSDPYAA
YGGYQNYVAYYQYYQQYAQQQQQQSQPQSQSQSPAPPPPTSEAPPPPPPGSGSPPPPPPG
GSYSAVRTLSQYYERKTLLTRHDIGSTATGPVNLSSARYLRWRQPQKQEESKYPNLLPSP
INSLIGQVKIYSLFPCLTSDEVGFGQYCVRARKDWNSSLSSIFFSQR
Download sequence
Identical sequences B8N9W7
XP_002377132.1.25037 5059.CADAFLAP00004997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]