SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5059.CADAFLAP00011196 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5059.CADAFLAP00011196
Domain Number 1 Region: 13-135
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-32
Family Calponin-homology domain, CH-domain 0.00044
Further Details:      
 
Weak hits

Sequence:  5059.CADAFLAP00011196
Domain Number - Region: 291-400,497-505
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.091
Family BAR domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5059.CADAFLAP00011196
Sequence length 511
Comment (Aspergillus flavus)
Sequence
MASVTSLDKDLRSLRLSRYTPQAAAEVRSWIEEVLHERLPAGDLLDALRDGVALCRLVNL
AVSPGVKYKQSSMPFVQMENISHFLRACQIAPLSLPPHDVFLTVDLYEAKDPAQVLQCLV
AFSRRANALQPGKFPRSIGPQSKVGALSPNATGSSQGAHTPSRPRGLSNANSSASGYSSP
AKSPGPVSSWSKRTDEHTTMPAWNIHQYGYMGGASQANQGVAFGARRQITTAAPNVPSLA
EKEKRRREEEERQRLEFEESERRRQEREAEEARARAEEERRWEEETARLKEQERRKLEEE
RKQWNDQQRRWEEEEEQRQREEREAEERLEKERLRRREVNDTRLNGQFLSQYQASQVGPN
QAPAESSERRRIRELERELETAKQREAEYQRERQEIQEKQAAPAATPAPRPVPVPPKPSY
NLSSLESERRLLRTEWNKHQTEESIAEAANPPPSLPPRPLPEPVATSPRPLPDPTLYASK
PANQESRGIGNMLNAHRQQGYLYAKLKPINE
Download sequence
Identical sequences B8NT12
5059.CADAFLAP00011196 XP_002383331.1.25037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]