SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5059.CADAFLAP00012088 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5059.CADAFLAP00012088
Domain Number 1 Region: 219-344
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.74e-29
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Domain Number 2 Region: 125-217
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.32e-25
Family Cold shock DNA-binding domain-like 0.0000648
Further Details:      
 
Domain Number 3 Region: 74-125
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.000000000366
Family ECR1 N-terminal domain-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5059.CADAFLAP00012088
Sequence length 372
Comment (Aspergillus flavus)
Sequence
MNVLTVRHPAVENFKRMAITILPPVVDHVDICPSDSDMDSMSVDSDGGVDLATGRTSRPS
KRPRLVEGTDITSGVVTPGEIVTDDPQWMRGHGTYINPLSTSIIATVAGTVQKTNKLLSV
QPLRARYTPEIGDLVVGRIVEVQSRRWKVDVAAPLLAQLPLSAINLPGGILRRRTSADEL
QIRTFFSEGDLVVAEVQTVHSDGAASLHTRSLKYGKLRNGVFLAVTGTGGSGASIVRSRR
QVWTVNTANGGGDVDVILGVNGYIWISKHADDTAAACSTTDSVSIYSSQNDDIPPQTRRE
IARLAQCIRVLVQGGVRVDEETVMSAYEASLQVDLEVGDDDDDDDDDRRREGREYLEGNK
ARRILELVLERN
Download sequence
Identical sequences B8NV58
5059.CADAFLAP00012088 XP_002384223.1.25037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]