SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5061.CADANGAP00001702 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5061.CADANGAP00001702
Domain Number 1 Region: 238-333
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000234
Family Eukaryotic type KH-domain (KH-domain type I) 0.0057
Further Details:      
 
Domain Number 2 Region: 541-586
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000307
Family Eukaryotic type KH-domain (KH-domain type I) 0.0055
Further Details:      
 
Domain Number 3 Region: 611-695
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000833
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Weak hits

Sequence:  5061.CADANGAP00001702
Domain Number - Region: 472-530
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5061.CADANGAP00001702
Sequence length 976
Comment (Aspergillus niger)
Sequence
MTSHSLRRPHGAPPMTPPTGIDPTVNLSFNVPFSSTLAGPDVDDVLHASPGALQRWTFPE
GTPEGTPVHQLPVHASNVDALRRLCRQITESSNGRVEAAVTSSEPKTVPSLQRRPQGLAT
NVCITGDGETVRKMRARVLNETPILLRCATVDVDMHLILDGTTKNIRASVLEHLDTLAAY
TGTDIFLLSPKIRDTDSAVVSSYGYASDNGLDQRFRVSIYGDMESAEHAKTRVLIMIDQI
LKRHVDAVKLELTMHTLVCGRTRKNIKLIEAATGTAIYFPPPFPRIFGYTPPGAHRRSEN
EVYITGDTQEQIARAKQKLQELVMGVKIYVKDVIVNSNKIDNILLDRLDKVRKVMEMNGS
YVLFPQLGTQRGLVRIQGTEVLHVERTVREIMALAGQFYSASWWIIMPDPSQGGFRAPSP
ADVRTMLSDICSNSGAEVSFDNLTFTINGSDDAVKAAMMVINQIPFVQRSQYQMRVKIEL
ANEHKEFVSGKKNGKINKIMGQSNVQIIFDGFNEYNFYIDVCGNQYESTKNGLDLVEQEM
PASISFHVPDQYHKRIIGIGGQHIQRIMKKYSVFVKFSNAMDRGGMGKEEDDIKVDNVIC
RTPARNAQSLDLVKQEIMDMVEKVDAEYVSERVVINRLYHRELLARMSEIDELEKKWNCK
IEFPSTELASDVVTISGPEYQVPQAVDALLGMVPESHELLFQSSAELREYFKSTEFHDDV
CAKLKDQYEVDTTVDTSSDPPASASESGSSSPVFGPEDRVVLGYTRNNAGGLKDAIDFLI
SRLVAHGLDATTVKGAIPRPKSDSFEESLPFFDSKLLQHAPAPIVTDSPTRPSFSDETSE
RGSIFERLRKPGSISSFSSFIGRKNHSASPGSFFKHASSNASKASLVSMESRDSGYRNPW
NDSGVNLAEDDVPVLGSSHSHSSSNGWPARFDTKFPFGTAPGDMTPKHDPRASFDSGRPS
TSNSTSGYPAPIGPPR
Download sequence
Identical sequences A2QC62
CADANGAP00001702 5061.CADANGAP00001702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]