SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5061.CADANGAP00005867 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5061.CADANGAP00005867
Domain Number 1 Region: 270-349
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.64e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00079
Further Details:      
 
Domain Number 2 Region: 123-206
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.62e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 3 Region: 37-108
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000147
Family Eukaryotic type KH-domain (KH-domain type I) 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5061.CADANGAP00005867
Sequence length 360
Comment (Aspergillus niger)
Sequence
MDPTELHDTTMVDETSPNNVDMIDDVDIETTPKTEEEYAQSMLTLRAIVSSKEAGIIIGK
SGKNVADLRDETGVKAGVSKVVPGVHDRVLTVTGPLNGTARAYALVAKGLLEGAPQMGMG
GIVSNNGTHPVRLLISHNQMGTIIGRQGLKIKHIQDASGVRMVAQKEMLPQSTERIVEVQ
GTPEGIEKAVWEIGKCLIDDWQRGTGTILYNPAVRASVGTTTSTSTMNQSVGNGYNSRPY
NRTGNGADFSDQSGGYGRRSNPDTSNRGYPLVTEDGEEIQTQNISIPADMVGCIIGRGGS
KITEIRRSSGARISIAKAPHDETGERMFTIMGSAQANEKALYLLYENLEAEKTRRSQLQE
Download sequence
Identical sequences A0A254UBK8 A2QNV5 G3XZ56
5061.CADANGAP00005867 CADANGAP00005867 XP_001391789.1.80561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]