SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5061.CADANGAP00005974 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5061.CADANGAP00005974
Domain Number 1 Region: 1066-1197,1229-1430
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.29e-65
Family p120GAP domain-like 0.00072
Further Details:      
 
Domain Number 2 Region: 285-442
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.38e-36
Family Calponin-homology domain, CH-domain 0.0000236
Further Details:      
 
Domain Number 3 Region: 1653-1752
Classification Level Classification E-value
Superfamily RGC domain-like 4.32e-30
Family RGC domain 0.001
Further Details:      
 
Weak hits

Sequence:  5061.CADANGAP00005974
Domain Number - Region: 487-594
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00141
Family Motor proteins 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5061.CADANGAP00005974
Sequence length 1753
Comment (Aspergillus niger)
Sequence
MSSNLASSRRTQTDLPDQTSNPLRHGSTASTSSSIYTVSSSSFAPSRTSTVSSTASSGSV
PGHRRGKSEVNTPISEAMAGGASDGKSWANAGATYENIRRSLRPLSQAPNSSPVAAKQAA
FRHSRSQTVDNPQYWKENRPQTPESRPAHPQDVDTLKEKPSYIDQSPTKTSSPHAVSPHT
KTQVKAHHAHSLSNPPPFTHTLSAPELETFQKSSTGHLRTLSKFAKSGETEEFALDSYGA
SVVGLQGRRRLKRADTVTGNNSPIARKKPAASAWTAGSWMDKQRQFLQAYEYLCHIGEAK
EWIEEVIQKQIPPIVQLEEGLRDGVTLAEVVQAMYPNRTFRIFRHPRLQYRHSDNIALFF
RFLDEVELPELFRFELIDLYEKKNLPKVIHCVHALSWLMFKKGLVDFRMGNLVGQLEFEH
HELEQTQKGLDKAGVSMPSFSGMAANFGAEPEPEPEPEPESEEDRIHRELHESEASIVDF
QAQLKGAMLRLKLGNLMNDLWDFEPFLVELQSRIRGDWARQIVQYRLDMRKFAVHLQAIC
RAFLVRQRQRALRGALQRQKVYDLYEGTRGAEKDVLLLQAAIRGALQRKQLATQYEETHS
AETDVTELQALIRGALQRSQLAKQYDAVQSTEPDVVELQAHIRGVLQRSRLAKQHETTQA
TEADVTVLQALIRGASVRQQMSTQNEAMNATTASTASLQGLIRGMLTRKGIEETKSLLSQ
EVPSITSIQAGARALAARKFLSQQAEALSKTANECASLQSIVRGNALRAELDRLRQDLNE
HVPSVIDVQSISRANAVRSFLNSQRESLKGEETSILALQSMARAVILRKRLEADAQALQQ
EEPVITNLQALIRAAILRIDVGGILEELDDCEYEISHFQAQIRAMLVRVDVGQTLADLAA
AEDVVMDLQSHIRGHLVRSRFEEKRRHYRENMDKVIKAQSYIRGRIQGQAYKSLTSGKNP
PVGTVKGFVHLLNDSEFDFDEEIEFERTRKLVVQQVRQNEMAEQYIGQLDIKIALLVRNK
ITLDEVVKHQKHFGGHVGSLLPNREISSKDPFDLKALNKTSRRKLEQYQVLFFLLQTQSQ
YLARLFRRLRELNTPEKEYDRIRHLMMGLFGYSQKRREEYYLIKLLARSAREEIESFDSL
HEYLRCNSFWNKLFASYIKSPRDRKFMRDILGTVVRENVVENPELDLESDPIQIYRSAIN
NEELRTGKRSRRRLDILREEAIRDPETRATFIQHLQDLRDIADQFFSAFEELLYRMPFGI
RYIAKQMYESLLARFPQENPGFILQTAGHWVWRNYFHPAMVEPEKYGVIDRGLTQEQKRN
LSEISKVIAQVASGRLFGAENVYLQPLNSYIGDSIQRLGQIWGDMVSVQDAETYFDIDEF
NDLYAKTKPTLYIKMSDIFSIHQLIASEVHYICQNPDDILKEVIRDLGNVKSNESELMSV
NSSEINLTLNPKLAQVEDPEADVKALFMETKRCILYIIRVQTGANLMDIMVKPPTEEDEA
KWMTLVRDELSANNTRRSPYSEATTMVDLASMSYTELKQTALENILQLEQTGKIRRDNYY
QDLLNAIAIDIRTKHRRRIQRERELDSARMTLARLNDQAIWLDQQLKTYNDYIEQAMVTL
QNKKGKKRFLMPFTKQWDHQRELQKSGKVFKFGSYKYSARNLADRGVLVHWKGYTERQWD
RVDLTISSNEVGVFTIDGSSGPMMIPGANAQVPLDDLLQAQFNNMQFLDFFDGHLRVNVN
LFLHLIMRKFYNE
Download sequence
Identical sequences A2QP50
CADANGAP00005974 5061.CADANGAP00005974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]