SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5061.CADANGAP00007064 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5061.CADANGAP00007064
Domain Number 1 Region: 15-154
Classification Level Classification E-value
Superfamily S13-like H2TH domain 3.39e-39
Family Ribosomal protein S13 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5061.CADANGAP00007064
Sequence length 155
Comment (Aspergillus niger)
Sequence
MSLVSGEKTNFQYILRLLNTNVDGKQKIMYALTQIKGVGRRYSNLVCKKADVDLSKRAGE
LTTEELERIVTILQSPTQYKIPTWFLNRQRDITDGKDSQVVSNSLDSKIREDLERLKKIR
SHRGLRHYWGLRVRGQHTKTTGRRGRTVGVSKKKN
Download sequence
Identical sequences A0A2K5AK32 A5AB20
5061.CADANGAP00007064 XP_001392986.1.80561 CADANGAP00007064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]