SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5062.CADAORAP00000908 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5062.CADAORAP00000908
Domain Number 1 Region: 884-986
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.8e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 2 Region: 1030-1112
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.38e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 3 Region: 216-313
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000146
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 4 Region: 1204-1295
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000994
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 5 Region: 710-784
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000105
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 6 Region: 302-407
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000143
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Domain Number 7 Region: 777-873
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000146
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 8 Region: 391-460
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000964
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Weak hits

Sequence:  5062.CADAORAP00000908
Domain Number - Region: 491-558
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.038
Family Eukaryotic type KH-domain (KH-domain type I) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5062.CADAORAP00000908
Sequence length 1303
Comment (Aspergillus oryzae)
Sequence
MASDLSNADVNGGIPKSRAAMLEEQHARDEVHKPTVEDVVDEEDLKHPPPSSSVQDQKVD
APAQSPAPTEVPAPKAAPKKAPAFDVQSEELFPALGSGPKPKAPAASAWGARGPSAAAAV
ANGIPGGSPAAQGPRIMSLPGKHVEQLRLAPSQMLPRGQLKKPLRDILRDISRRSKANVD
MRGGPGGSIIFEGKGSVDAVRQALKEVAQQVGSKQSVRVPIPTSARPHIIGRQGAVVQDM
QQRTGARVQVPRVDESAGQVEDDEDTIDVLIEGDAVAAEMARREIEAIVKERASNMSLRL
KSIPPEFFPFIAGAHNANLRDIEQRTNAQVHVPRYDTWQSQPPPQEADPGHVQFVAIPEK
HIHISGERAAAQEARAEIERLAADLQRQLTLRQLAINRGQHQFILGDNADALHEFLADTG
CAIVLPPASDDSEFLTITGPLDSIENGINRAMDLATSMQMASIDLSRQHPNAPSGAHAHA
RALTRYLRQRQIIKELESMYDARIALPPSSDGPVTWEVYSRDGKNTIRARSDIMNLVHAH
PPARLRHISVDPYFHPYIRSRAIPKLQEEYGVHVLTPEELDCPDVVLVYEGPSATASQFE
VPRQRPTTAELAAFEKALQEAQEYLSSVLGDQNDIVAKSVTVPAKYQEKVRKFIAREEQA
KGEDLIPVRALVAEPSGRGAECEVALRGPSRLVEELISKLQAFVTEQEKDDLERGYTTSF
DFPQKFANFLIGKKGENINKLREEFDVDIKVENGKVEVKGPKAKADAAKARIINLGKKLE
DETTHILKIPAQYHRELIGQQGSQVNRLQDRYHVRVQFPRAAPIVADDQSVEASSEAGGS
RPSRPQQGADEVIVKGPSKGADATRDELLSLLQWVVDHSHSGSVSVAQSQIPSLIGQRGR
EMDKLRADTGARIDVPGADDTPDASGRVQIKIKGTKKQVEEAKKILEQRSNEFDATVTKT
IDIDKKYHKSLIGGGGANIRKIVADAGGPTDGGASRIVRFPRPESAETTIKLEGNGQVVD
KIIAAIEEFVKERADQVTANVEVPSTQHRLLIGRGGETRRGIESKFNITLDIPKQGSGRS
DIKLKGPSNAVAEAKEHILSMLKDQQGETVEVPRHLHHAISDNGSFFRRLRNDYQVTVDH
AGQQVPSKPSSEDTRGAANGGSSLPLITDEPDQAADAHSWKVVENAPAANDPTQPATIPW
VLAGNRDNVAKAKAALEKAIANASQQSATGYLILPDPKTYRFVVGQGGSQINAIRKQTGC
RINVPKDQAKGEAIEVKGNKESLEQAKDMILEAVRAGLEGNSR
Download sequence
Identical sequences Q2ULU1
5062.CADAORAP00000908 AO090003000269 XP_001819476.1.101437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]