SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5062.CADAORAP00000932 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5062.CADAORAP00000932
Domain Number 1 Region: 388-461
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0003
Further Details:      
 
Domain Number 2 Region: 105-182
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000972
Family Eukaryotic type KH-domain (KH-domain type I) 0.00081
Further Details:      
 
Domain Number 3 Region: 190-267
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000105
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5062.CADAORAP00000932
Sequence length 482
Comment (Aspergillus oryzae)
Sequence
MSASPSALQSTKRPLEDPSSPSGPNDQPEAKRPALDKVVKGDESEAYAEVKTESSGVPSA
SADGQGDTVVPDAPNAKGTNPETQPIQSTASHAETGSQSEQHRPQDESSWIHIRAVISSQ
EAATVIGKGGENVSQIRRLSGAKCTVSDYSRGAVERILTVSGPQDAVAKAFGLIIRTLNN
EPLDAPSTAQSKTYPLRLLIPHILIGSIIGKGGGRIREIQEASGARLNASDACLPLSTER
SLVILGVADAVHIATYYVAVTLVEQLTERFGGPAASAYATRSGGPAGAVPGGMQVVPYVP
QPAGGQYGHPDTFKRHHPHPNRAAAGAYGVPYLHGQPAPAPVAQPAMHYGGAPQPYAGAG
PHQPAPYGAPQAAPARGGPTPVAPVGGAMPGQPLTQQIYIPNDMVGAIIGKGGAKINEIR
HLSGSVIKINEPQENSNERLVTITGTQECNQMALYMLYSRLGFQQYVACVAPLPSIAHFL
PC
Download sequence
Identical sequences I7ZNF6 Q2ULR7
5062.CADAORAP00000932 AO090003000297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]