SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5062.CADAORAP00005898 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5062.CADAORAP00005898
Domain Number 1 Region: 30-93
Classification Level Classification E-value
Superfamily SNARE fusion complex 2.98e-19
Family SNARE fusion complex 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5062.CADAORAP00005898
Sequence length 122
Comment (Aspergillus oryzae)
Sequence
MSEQPYDPYIPSGSTTNAPAGASAAQNGDPRTREIDKKIQETVDTMRSNIFKVSERGERL
DSLQDKTDNLAVSAQGFRRGANRVRKQMWWKDMKMRVCLVICVILLLVVIIVPAGSSLFP
RH
Download sequence
Identical sequences Q2UCV7
5062.CADAORAP00005898 AO090012000430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]