SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5062.CADAORAP00008365 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5062.CADAORAP00008365
Domain Number 1 Region: 121-224
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.25e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5062.CADAORAP00008365
Sequence length 359
Comment (Aspergillus oryzae)
Sequence
MPSTYKRDKPWDTDDIDKWKIEPFKSEDNVAGSFAEESSFATLFPKYREVYLKEAWPLVT
RALEKQGIACTLDLVEGSMTVKTTRKTYDPAAILKARDLIKLLARSVPVQQALKILEDGV
ACDIIKIRSQVRNKERFVKRRQRILGPNGSTLKALELLTQTYILVQGNTVSAMGPYKGLK
EVRKVVNDCMANIHPIYHIKELMIKRELAKDPTLANESWDRFLPNFKKRTLSKRRTPFKV
TDKSKKVYTPFPPAPEKSKVDLQIESGEYFLSKEAKDRAQKEELMEKQRVKREEKMKERA
KAFVPPEELESAKKEKKEKKEKKRKREAEAEADVDGSEKKEKKKKKSKSKESASSDGES
Download sequence
Identical sequences Q2UER8
XP_001821949.1.101437 AO090026000510 5062.CADAORAP00008365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]