SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5062.CADAORAP00010993 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5062.CADAORAP00010993
Domain Number 1 Region: 10-137
Classification Level Classification E-value
Superfamily Histone-fold 2.26e-37
Family TBP-associated factors, TAFs 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5062.CADAORAP00010993
Sequence length 142
Comment (Aspergillus oryzae)
Sequence
MSDREFSSNDDLSLPKATVQKIITEILPPSSGQTFSKDARDLLMECCVEFITLISSEAND
ISEKEAKKTIACEHVERALRDLGFGDYIPDVLAVAEEHKEQLKSREKKQSKMEQSGLSEE
ELLRQQQELFRSATEKYHAAPE
Download sequence
Identical sequences A0A0F8VBX2 A0A0F8WWZ4 A0A1F8A9E1 A0A1S9D981 B8NLB2 I8A4S0 Q2U6Y7
XP_001823811.1.101437 XP_002380859.1.25037 AO090120000041 5059.CADAFLAP00008724 5062.CADAORAP00010993 AFL2T_08078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]