SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5085.CADAFUAP00001979 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5085.CADAFUAP00001979
Domain Number 1 Region: 157-251
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.49e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5085.CADAFUAP00001979
Sequence length 252
Comment (Aspergillus fumigatus)
Sequence
MPAPTALLRKSDEPLSAEEPSLTFSSDAQASGQGEAPSPIPTESAQHSDMRIDEESRPVF
TPITDAGTVLRVETRKVPVPPHRMTPLKANWPKIYPPLVEHLKLQVRMNIKNRAVELRTS
KFTTDTGALQKGEDFVKAFTLGFDVDDAIALLRLDDLYIRSFEIRDVKASLNGEHLSRAI
GRIAGKDGKTKFAIENASRTRVVLQGTKVTILGRFRDLGIAQEAIVSLILGSPPGKVYGN
LRKVASRMKERF
Download sequence
Identical sequences Q4WNG7
XP_750535.1.65241 5085.CADAFUAP00001979 Afu6g06430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]