SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5085.CADAFUAP00003337 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5085.CADAFUAP00003337
Domain Number 1 Region: 264-343
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.5e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00079
Further Details:      
 
Domain Number 2 Region: 115-197
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.21e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 3 Region: 32-103
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000253
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5085.CADAFUAP00003337
Sequence length 355
Comment (Aspergillus fumigatus)
Sequence
MRDAPPVDETMADAVNVADEGDMEVTPKTEEEYAQSMLTLRAIVSSKEAGVIIGKAGKNV
ADLRDETGVKAGVSKVVPGVHDRVLTVTGPLQGTARAYALVAKGLLEGAPQMGMGGIVNN
NGTHPVRLLISHNQMGTIIGRQGLKIKHIQDASGVRMVAQKEMLPQSTERIVEVQGTPEG
IEKAVWEIGKCLIDDWQRGTGTILYNPAVRASVGGSTSMNTSSVGNGYSSRPYNRTGNGA
DFSDGQSGGYGRRSNPDTSNRGYPLVTEDGEEIQTQNISIPADMVGCIIGRGGSKITEIR
RSSGARISIAKAPHDETGERMFTIMGSAQANEKALYLLYENLEAEKTRRSQLPQE
Download sequence
Identical sequences B0XU88 Q4WI80
Afu2g02780 Afum_A1163:AFUB_019880.t1 XP_749413.1.65241 5085.CADAFUAP00003337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]