SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5085.CADAFUAP00003482 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5085.CADAFUAP00003482
Domain Number 1 Region: 73-171
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.88e-21
Family Cold shock DNA-binding domain-like 0.0018
Further Details:      
 
Domain Number 2 Region: 167-271
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000055
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5085.CADAFUAP00003482
Sequence length 274
Comment (Aspergillus fumigatus)
Sequence
MSSPVILLPGDHVPSDKLPSNKSAPLRLGPGLRLLSPAIPSPSSGHVIASTQAGLLSTDY
KKNAVSVLSFPNRRYIPTPNDLVIAQVHHSSAEYFYCMITPQSPHVLLGQLAFEGATKKT
RPMLRQGDLVYARVLSIGLGAGAEVELTCVNPATGKAEPGGLGPLNGGMVFDVSTGMAAR
LMRASSSTSEQEDGVDGLVVLEELGRKLEKVGGFEIAVGRNGKVWVDCSNGGDAAVKATV
AIGRCLTAIDEHDLNQTDQRKLVTRILREMKVES
Download sequence
Identical sequences A0A0J5SX98 A0A229Y7F6 B0XTX5 Q4WIC4
Afu2g02340 5085.CADAFUAP00003482 Afum_A1163:AFUB_019430.t1 XP_749369.1.65241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]