SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5085.CADAFUAP00003714 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5085.CADAFUAP00003714
Domain Number 1 Region: 1037-1119
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.09e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 2 Region: 889-994
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000148
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 3 Region: 200-297
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000115
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Domain Number 4 Region: 1238-1302
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 5 Region: 714-789
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000599
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 6 Region: 781-881
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 7 Region: 308-414
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000013
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Domain Number 8 Region: 398-466
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000351
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5085.CADAFUAP00003714
Sequence length 1310
Comment (Aspergillus fumigatus)
Sequence
MMASQVQSSDVNGGAKSLAAMLEEEHARNEAHKVTVEDTVDEEDLLHPPPSLGKDQQTVP
AQPTAAIEEAVATTPSASNAAPKRSPAFDVRSEELFPALGSGPKPKAPAAATWGARPSAA
AALANGAAGRPQSTAGDVPRIMSLPGKHMEQLRLAPSQMMPRAQLKKPLKDILRDISRRS
KATVDMRGGPGGSIIFEGKGSVESVRQALKEVAQQVGSKQSVRIPIPTSARAHIIGRQGA
IVQDIQQRTGARVQVPRADDSAAKDDEDDNDTIDVLIEGDAVAAEMARREIEAIVKERAS
NMSLRLKSIPAEFFPFIAGAHNANLKAIEERTKAQVHVPRYDTWQSQPPPQEAEPGRVQF
VPAPDKHIQITGERTAAQEARAEIERLAADLQRRLTLRQLAINRGQHQFILGDGANALHD
FLADTGCAIVLPPASDDSEFLTITGPQDCIEAGINRAMELATSMQMASIDLSRQHPNAPS
GPHAHARALTRYLQQRQIIRQLEQMYDARIALPPSADGPVTWEVYSRDGKNTIRARSDIM
NLVQAHPPARLRYVSVDPYYHPYLESHGLGKLRNDYGVHLLVPDELDSSDVVLVYEGPSA
ANSLPEIPRQRPSPAEVAAFEKSLQEAQDFLTQLLGDQNDIVAKSVKVPAKYQEKVRKFI
AREQQAKGDDHIPVRALVGDARNDKCDVSLRGPSRQVDELVAKLQDFVVGQEKDDLERGY
TISFDFPQKFANFLIGKRGENINKLREEFDVDIKVDNGKVEVKGPKAKADAAKTRIINLG
KKLEDETTHVLKIPAQYHRELIGQKGSQVNRLQDRYSVRVQFPRAAVATPSFDDQSVADT
SSEVGGSRPIRPNQAPDEVIVKGPSKGADAARDEILSLLQWVIDHSHSATVSVAQSQIPS
LIGQRGREMDKLRADTGAQIDVPGANDAPDASGRVQIKIKGTKQQVEEAKKILLQRSSEF
DAIVTKTIDVDKKYHKALIGAGGANIRKIVTEAGGPTDGSASRIVRFPRPDSSESTIKLE
GNGKVVDNIIAAIEAFVREREDQVTVTVDIPPVQHRLLIGRGGETRRGIESQFNVTLDIP
KQGSGRTDIKLKGPSNAVESAKEHILAMLKDQQGETVEVPRHLHHVVADNGAFFRRLRND
YRVTVDHAGQQVPLKPASEESRATTNGASSLPLITDEPSDSVDAHSWKVVDHSDASQDAT
QPATIPWVLIGSSDNVARAKSALEKAIASASQQTSTGYLILPDPKTYRFVIGQGGSQINT
IRKQTGCRINVPKDQARGEAIEIKGSKDGLEKAKEMILDAVRAGLNGGSR
Download sequence
Identical sequences B0XV57 Q4WHP1
5085.CADAFUAP00003714 Afu2g04700 XP_749602.1.65241 Afum_A1163:AFUB_021730.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]