SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5085.CADAFUAP00008115 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5085.CADAFUAP00008115
Domain Number 1 Region: 256-368
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.89e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 2 Region: 158-241
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000167
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5085.CADAFUAP00008115
Sequence length 503
Comment (Aspergillus fumigatus)
Sequence
MADDERRAKRSRFDQTEPEPRRASRFDRRSRSPSSRQPESTRTRSPLSREPFSPGADDSR
KSGSVDPAAAAGMANKPASNVFLLPQKLTIWKSEQLLQRPRSTPSCKPRKEFSTSMSLPY
VRPAPNAASPSSASDTKKLNTEIYVADGDYIKDIEINDLRNRYTLTKGSTQKMIKDQTGA
DVTTRGSYYPDKSMATPANPPLYLHVTSTTKEGLEKAVALIDELMQKELPNLVDERRFRR
REPDQVERDEYGRRKWPEERIPVDLEPIPGFNLRAQVVGQGGAYVKHIQQKTRCKVQIKG
RGSGFLEPSTGRESDEPMFLHVAGPDPNDVQAAKELCEDLLANVREQYQRFKDNPPQHSY
GGYGQRGGDRYYGGGYGGGYSSQHNQQHSNSPSATASPAQATSGTSGAAGAGSPADYSAQ
YAQYYGADPYAAYGGYQNYVAYYQYYQQAAQQQQQQQQSSQSQSPAPPPPPPASEAPPPP
PPGSGSPPPPPPGGGSYSAVSIN
Download sequence
Identical sequences B0Y5R4 Q4WNW8
XP_752104.1.65241 Afum_A1163:AFUB_064310.t1 5085.CADAFUAP00008115 Afu4g07220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]