SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5085.CADAFUAP00008752 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5085.CADAFUAP00008752
Domain Number 1 Region: 652-772,805-860
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.64e-20
Family Calponin-homology domain, CH-domain 0.0021
Further Details:      
 
Weak hits

Sequence:  5085.CADAFUAP00008752
Domain Number - Region: 895-987
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.069
Family Extended AAA-ATPase domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5085.CADAFUAP00008752
Sequence length 1015
Comment (Aspergillus fumigatus)
Sequence
MSGLLQEVGTPCPVKSKNSRNSDTVHTFDSSWERILECGDDTANLEFTTVIKNNTLIGVK
PKRRVKTGTSFAIHDESKERPTHAVPKRKGESTITARVSSRKSSLLAQPAHRFRPKVSFT
SSSPSKAQLQKEEAKHQKQNIDASAKANRSLLMRINSGGVEDEHKDKLKREVRRNTVFIP
PDDTTIASVFMSLFSPLKSDNLDHYVPEDTEINSLESQIVRKRQAKTTMASGRKTPLQPS
LKVVQRSAMNIDIAGKITGKENIPPGEMIFSSNDKGLWKSNTEDKFLNSESPRILSDKAR
PFANPVTERLAKVATNQGLRRSVPGEKRYNARASVNGIGSKMDGIVRSRSRLEGAAVLSA
SRKTPLSNAFEQSKTYKMNASLVKKETAMTDFALISDDIVSPAMYEDRWLVHQEIVITQL
INRLFDRTNGQVRYDDPAARRHELLQLYQSGPFVELHKRLQASLTYGSLGIPKDALTQTK
RLKHDLGMKRKFLDIWLETYDLRALRAAAETVTGRRVENESLDGDSHHFSVETTADKEKI
LRRKLERFLDVFLVQNKDMDRDSQDLSHAGSDMISQAYRRTVLRSIMIVILLDKARLCPG
TVLPSCLFRFSSSFKSSTAVIQALARLLLPASGDILRSLKHLDCHLSYEQHQLQEYEYQL
SNLAVDLRDGVRLTRIVELLLYSSAGAVGGSVPPLDNDQWPLSRRLKFPCSSRTVKQFNV
QIALDALRLAPDAAPLVRDVRAEDIVNGHREKTIALLWGLVSRWGLSELIDWDDVRKEID
RLRQKATSQLGYGQVNDANLFKEKSPKDGITDDNEAILLLKEWAIILAHLSGFQLENLST
SFADGRIYEAIVNEYEEYILGNVASSPGQKPTSLAARLRALGCSSQFANLVSPSNSRKAH
IFDSSFTVGGLAFLCSRLLSSTKRARAAIVLQSAWRRVLAHREAHRRDVARNLALQCAAV
VQTRDRLLRAKTIILRWWRRLKKQRQQRSKMGSRSEKRLQAATRAPRCGYGRTRV
Download sequence
Identical sequences B0XNS0 Q4WJS9
Afu1g04920 5085.CADAFUAP00008752 XP_750241.1.65241 Afum_A1163:AFUB_005290.t1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]