SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 508765.CLL_A0044 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  508765.CLL_A0044
Domain Number - Region: 14-57
Classification Level Classification E-value
Superfamily Oxygen-evolving enhancer protein 3, 0.0131
Family Oxygen-evolving enhancer protein 3, 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 508765.CLL_A0044
Sequence length 114
Comment (Clostridium botulinum B Eklund 17B)
Sequence
MFEKNKDISTEMKQLKRILKSIPKDRQPIAQNIYNELLFIQRTLDKLKKDVDEEGTTTLF
KQGQQEFLRENPALKGYNTTIKNYSSLYRQLIDLLPPLEPVQEVDPLLDFIKAQ
Download sequence
Identical sequences B2THE6
gi|187932685|ref|YP_001884298.1| WP_012422942.1.45387 WP_012422942.1.55913 508765.CLL_A0044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]