SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 508765.CLL_A1279 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  508765.CLL_A1279
Domain Number 1 Region: 290-486
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.1e-47
Family Ribonuclease PH domain 1-like 0.0000162
Further Details:      
 
Domain Number 2 Region: 8-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.13e-40
Family Ribonuclease PH domain 1-like 0.0000291
Further Details:      
 
Domain Number 3 Region: 136-228
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.42e-26
Family Ribonuclease PH domain 2-like 0.0047
Further Details:      
 
Domain Number 4 Region: 447-547
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.7e-23
Family Ribonuclease PH domain 2-like 0.00013
Further Details:      
 
Domain Number 5 Region: 606-694
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.71e-21
Family Cold shock DNA-binding domain-like 0.00049
Further Details:      
 
Domain Number 6 Region: 236-317
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 2.09e-19
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0032
Further Details:      
 
Domain Number 7 Region: 551-628
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.55e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 508765.CLL_A1279
Sequence length 704
Comment (Clostridium botulinum B Eklund 17B)
Sequence
MNNVLSTNIAGKEMKVEFGKIGMLSNAATFMSYGDTVILTNVNASSEPRVGIDFFPLSVE
YEERLYAVGKIPGGFIKREGRPSEKAILNGRAVDRTLRPLFPKGYRNDVQVVCTVVSVEK
DNLPEILAINAASMALCLSSIPFTIPVAAVQVGLIDNNFIVNPNATEREESTLHLTVCAT
KERVMMIEAGGNEIPEDIMIDAIKFGFDECQKIINFQEEAVSKFGKEKDVPTLFTVDEEV
EKDIKEFASDMIKEAMYITDKDERNAAIDAVNQKVKEEFGEKYEDKFGDIKEVLYNMQKK
VVRHMLLKDKRRPDGRAFDEVRPLGCEIGLLPRTHGTGLFTRGLTQVMTVATLGAVGDIQ
ILDGIDEAQSKRYMHHYNFPGYSVGEVKPLRGPGRREIGHGALAERALEPLIPSEEEFPY
TIRLVSEVLSSNGSTSQASVCGSTLALLDAGVPLKRPAAGIAMGLITSEDLSEEQVLTDI
QGIEDFFGDMDFKVAGTTEGITSIQVDTKLKGFSFNVVENAIRDARKARMTILDKINECI
SSPREDVSLYAPKTETIQIDPDKIRSVIGAGGKVINKIIQDTGVKIDIKEDGSVFVSSSD
HAGVKEAIKIIEGLTKDVKAGEIYLGKVTKITTFGAFVEILPNKEGLVHISKLDKERVNK
VEDVVSVGDEILVKVTEIDSQGRINLSRKDVLLDQENKENKEEK
Download sequence
Identical sequences B2TJ61
WP_012424453.1.45387 WP_012424453.1.49945 WP_012424453.1.55913 508765.CLL_A1279 gi|187934276|ref|YP_001885477.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]