SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 511995.CFPG_036 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  511995.CFPG_036
Domain Number 1 Region: 307-464
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.92e-26
Family HD domain 0.028
Further Details:      
 
Domain Number 2 Region: 200-291
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.89e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 511995.CFPG_036
Sequence length 514
Comment (Candidatus Azobacteroides pseudotrichonymphae genomovar CFP2)
Sequence
MTSTIIFISIAAVFLVMGGYSAWWKINSICEIRNKKIFNEAKKELESAKKIEILEMKEKF
SSMKANIERQVNERNAKLQLHEVDLKQRESIVKKKQEELYKKNNELEVIRENLASQLEII
GKKKQEMDKIHRMEIERLESLSGLSAEEVRERLAQSLKEEAKTAAAAYINETIEEAKMTA
NKEAKKIVIQSIQRIATETAIENSVTVFQIDSDEIKGRIIGREGRNIRTLEASTGVEIIV
DDTPEAIVLTGFDPVRREVARLALHHLIQDGRIHPARIEETVEKMRKQVEDEIIEIGKRT
TIDLGIHGLHPELIRMIGRMKYRSSYGQNLLQHSRETANLCAIMASELKLNPKRAKRAGL
LHDIGKVPDDEPELPHALLGMKLAEKYKEKSDICNAIGAHHDEIEMETLLAPIVQVCDAI
SGSRPGARREIIESYIKRLNDLEQLALSYPGVVKTYAIQAGRELRVIVGADQINDVETEK
LSNEIARKIQDEITYPGQVKITVIRETRAVAFAK
Download sequence
Identical sequences B6YQ27
gi|212550393|ref|YP_002308710.1| 511995.CFPG_036 WP_012573060.1.38342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]