SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 512562.HPSH_03025 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  512562.HPSH_03025
Domain Number 1 Region: 305-449
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.8e-24
Family HD domain 0.02
Further Details:      
 
Domain Number 2 Region: 188-271
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000759
Family Eukaryotic type KH-domain (KH-domain type I) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 512562.HPSH_03025
Sequence length 503
Comment (Helicobacter pylori Shi470)
Sequence
MKKIYYARGQTILKGASAKAKLMEFQAKSFVEAEEMRMKSQECKLQQQYENKNLQLQTHF
EKKEVHLKHLEAQHKEFVRDEKRYLEKEKQELEKERQILEQEKENFKKQCAVCKEAQAKA
LDAMLNYMAYTKDEIKNMVLEQLEEELEVQKSALIKRYEKEAKEEGKKRSYAILAEATAR
FAGNYAAENLTTRIALPCSDYIGRVIGKDGKNIEAFKKVSGVDIEFSEGSSELYLSSFNL
YRREVASETLKILIEDGRIQPNRIEEVYHRVARNMEKELLSEGESVVLELELGAMEDELK
ILIGKMRYRSSFGQNALQHSKEVALLAGLIAEQLEGDKKLARRAGILHDIGKALTQELGR
DHVNLGVEVCKRHKEDPVVINAIYAHHGHEEIMSVECASVCAADALSAGRPGARRKSDEE
YAKRMQALEEIALEFDGVEKAYAMESGRELRVIVKSNQVRDNQVPIIARKIAKKIEESAQ
YVGEVGVQVVRESRFKTTATLKQ
Download sequence
Identical sequences 512562.HPSH_03025 gi|188527396|ref|YP_001910083.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]