SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 512562.HPSH_06280 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  512562.HPSH_06280
Domain Number 1 Region: 299-466
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.13e-36
Family Ribonuclease PH domain 1-like 0.0000976
Further Details:      
 
Domain Number 2 Region: 9-139
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.1e-36
Family Ribonuclease PH domain 1-like 0.00015
Further Details:      
 
Domain Number 3 Region: 448-542
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.49e-22
Family Ribonuclease PH domain 2-like 0.00016
Further Details:      
 
Domain Number 4 Region: 144-230
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.23e-16
Family Ribonuclease PH domain 2-like 0.0053
Further Details:      
 
Domain Number 5 Region: 552-642
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000453
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Domain Number 6 Region: 240-325
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.000000000615
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.011
Further Details:      
 
Domain Number 7 Region: 616-685
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000224
Family Cold shock DNA-binding domain-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 512562.HPSH_06280
Sequence length 688
Comment (Helicobacter pylori Shi470)
Sequence
MDFITITSSNKTEEFALKQVAKQATSSLMYRLGKTIILASVCVEREPVGEDFLPLVVQFL
EKSYAAGKIPGGFVKREGRAQDFEILTSRLIDRTLRPLFPKDYRYPTQITLMVLSHDVEN
DLQVSALNAASAALFLSHIAPIKSVSACRIARIGNEFIINPNTSLLNQSSLDLFVSGTKE
SLNMIEMRSLGQQLNALEEPLMLKALELAQKSLKETCTLYEEIFTPHQNELLFKESQGII
FNERLLDLLKNQYFDEIIKGIESSALSERENVFNEIARKISEAHSEFSLKEIELSLEKVK
KTEIRCMIIKDKIRPDKRALEEVRPILIESDLLPMAHSSILFTRGQTQSLVVGVLGTDND
AQTHESLEHKAPIKERFMFHYNFPPFCVGEASSIGATSRRELGHGNLAKRALETSIKNKD
QVIRLVSEILESNGSSSMASVCAGSLALYASGVEIYDLIAGVAMGMVSEGQDHAILSDIS
GLEDAEGDMDFKIAGNLEGITAMQMDTKMSGIQLEVLYQALLQAKKAREHILKIMHEAKE
KIVINFSHLPTTEIFNVAPDKIVEIIGQGGRVIREIVEKFEVKIDLNKPSGEVKIMGNKE
RVLKTKEFILNYLHSLDQELEQYAIDEVLEAQVKRIVDFGAFLSLPKGGEGLLRKQNMDR
CQVVLKEGDSIKCRVISFNKGKIALDLA
Download sequence
Identical sequences B2UUX6
512562.HPSH_06280 gi|188528001|ref|YP_001910688.1| WP_000345886.1.69492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]