SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5141.NCU01665.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5141.NCU01665.1
Domain Number 1 Region: 228-331
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.2e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 2 Region: 129-214
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000518
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5141.NCU01665.1
Sequence length 523
Comment (Neurospora crassa)
Sequence
MDDAERRSAKRSRFDQTEPEPKRVSRFDRRSRSPPARKSDSGRDRDRSPLSKPRDSATPD
STKPAVDPAAAAAAAAARIQAQLQARKGIQHVDVPPVRSAGTREGSVPANINGEMYISDG
DFIKDIEVNDLRNRYLLTKGSTQKMIKDETGADVTTRGSYYPDKSMATPANPPLYLHVTS
TTKEGLEKAVAKIEEMMKQELPQLVDERRFRRRDQEQVERDEYGRRKWPEERIPINLEPV
PGFNLRAQVVGHGGAYVKHIQQETGCRVQIKGRGSGYIEASTGRESDDDMYLHVAGPDPK
MVEKAKELCEDLMENVKQQYEEFKSRPPRQYNGPRDYRDREREPRGGDSYHGRGYNNNNS
NNNNHRDHHHGGHHDNSHHSSYTNSPAPGGGPSVAPPTPTAPAAATTDYAAQYAQYYGGA
AATDPYAAAGAADPYAAYGGYQAYVQLYQQWYAAQAGQVTPAAAATGVPGAPGASASPPP
PPPTEAAPPPPPPPSSAAPPPPPPGAPPGMSGGYSAVPPPPGL
Download sequence
Identical sequences Q96U73 V5IQ47
5141.NCU01665.1 XP_011393474.1.24337 XP_011393475.1.24337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]