SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5141.NCU01763.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5141.NCU01763.1
Domain Number 1 Region: 16-113
Classification Level Classification E-value
Superfamily Acyl-CoA binding protein 5.62e-20
Family Acyl-CoA binding protein 0.001
Further Details:      
 
Weak hits

Sequence:  5141.NCU01763.1
Domain Number - Region: 138-186
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0523
Family beta-sandwich domain of Sec23/24 0.035
Further Details:      
 
Domain Number - Region: 265-298
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0889
Family Calponin-homology domain, CH-domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5141.NCU01763.1
Sequence length 337
Comment (Neurospora crassa)
Sequence
MLEANTQLTFPPFPSDRVFVHALNTVKKIPKTGAARPPPGDRMRLYGLYKQAMEGDVDGV
MERPSAATAYGAAPEDIAREQDKWDAWNSQKGLSRTEAKRRYVEALIETMHRYANNTPNA
LELVAELEFVWNQVKSNSPSEQSLAGGGLQQQQQQPQQHQPYNNGGHGGSYGYGSVGPYG
QSPGAGVRRFQHPLSGTEGGLRVLSPMSEEDESERRMREEAEQELFGADEFPGEYAKRND
KRTKRMERAIVRLSAEIAALREQISSGREWKTRKEKSFTNWIGWWFWVLVKHFIIDLFIL
VVLLLWMRKRKDRRLEDYVRGTLKLAREYARLVLPSR
Download sequence
Identical sequences 5141.NCU01763.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]