SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5141.NCU02204.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5141.NCU02204.1
Domain Number 1 Region: 181-264
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 4.36e-28
Family SWIB/MDM2 domain 0.001
Further Details:      
 
Domain Number 2 Region: 15-60
Classification Level Classification E-value
Superfamily DEK C-terminal domain 0.00000000968
Family DEK C-terminal domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5141.NCU02204.1
Sequence length 265
Comment (Neurospora crassa)
Sequence
MAAQFTPEEEATYARVIDEILETADLDTISRKAIRQKMEAAINKDLSDQKHAIKGLIEAR
FDAAQARKAAQEPTPEEATPEATPDSDEDDAATDGEIEVRPKKQQKRESSEDADARLAAE
LQAQENKLSRGPRTRGGGAAKVTKKSKPKAKTPKKKSATRVKSDDDSDMEPEEVEGTKKR
KAGGGFQKPFNLSYPLQEVCGEAQLSRPQVVKKLWEHIKANELQDPSDKRQIICDEKLQA
VFKQSSINMFQMNKLLGNQLYPIEE
Download sequence
Identical sequences A0A0B0E1K7 Q7S468
NCU02204T0 XP_959523.1.24337 5141.NCU02204.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]