SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5141.NCU06251.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5141.NCU06251.1
Domain Number 1 Region: 276-357
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.4e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00048
Further Details:      
 
Domain Number 2 Region: 130-219
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.41e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 3 Region: 43-116
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000269
Family Eukaryotic type KH-domain (KH-domain type I) 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5141.NCU06251.1
Sequence length 371
Comment (Neurospora crassa)
Sequence
MSASQDPIPANGGSIEENLDHLKLDDNEPRLGPDGEPAPRTDEEYAQTTLTLRAIVSSKE
AGVIIGKGGQNVANLRDETGVKAGVSKVVQGVHDRVLTITGGCDAVSKAYAVVARSLLEG
APSVGMGGVISANGTHPIKLLISHNQMGTVIGRQGLKIKHIQDVSGVRMVAQKEMLPQST
ERVVEVQGTPEGIQRAVWEICKCLVDDWQRGTGTVLYNPVVRGGGQPLGGDRNYPQERSY
GSSRVTRTGNGADFSSNSGGRPYNRRSDSDAASRGPPTHDENGEEIQTQNISIPADMVGC
IIGRQGSKISEIRKASGARISIAKGPHDESGERMFTIMGSAKANETALYLLYENLEAEKT
RRSQQALEPSE
Download sequence
Identical sequences A0A0B0E295 U9W326
XP_011393896.1.24337 XP_011393897.1.24337 XP_011393898.1.24337 NCU06251T0 5141.NCU06251.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]