SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5141.NCU06429.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5141.NCU06429.1
Domain Number 1 Region: 308-538
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.96e-83
Family Calponin-homology domain, CH-domain 0.0000403
Further Details:      
 
Domain Number 2 Region: 558-680
Classification Level Classification E-value
Superfamily Spectrin repeat 7.48e-30
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 3 Region: 781-933
Classification Level Classification E-value
Superfamily EF-hand 2.37e-17
Family Calmodulin-like 0.0053
Further Details:      
 
Domain Number 4 Region: 682-788
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000748
Family Spectrin repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5141.NCU06429.1
Sequence length 1027
Comment (Neurospora crassa)
Sequence
MEMLGVEIGEPGPSVQSGQPAAALPDPATAPARAAAQSPTQSTNSTTSTRSGPASLARSR
SSTAGASTTCSSRSWGETHSGGPAQVEKFPDLPTHTTSPEHQQQPLHHHPHPHHRHHHHH
QPASEAVRRDGTCAHTAEGTPTPPAAPAAPATPTPVPRLNTDHTELASPGPPPAASCPAI
GRPPSLSIHSTASSSDHSSSLSDGDLVFDSRRSSVVTSASTASAYNYPLSPSCHQPDSSP
EHPLTRTRRDAKQLHAARLERSGSISLALASTKREAPSPALRNPTRFQRASSEPTRAPKL
VTEQPAGFTKMAFAEQQQWITVQQKTFTKWLNTKIEVRGLEVKDLVKDLSDAVMLIHLLE
CLSGDSLGRYAAKPKLRVQRFENANLALNFIKSRGIQMTNIGAEDIVDGNRKIILGLIWT
LILRFTINDINEEGMTAKEGLLLWCQRKTACYDEVDVRDFSGSWNDGLAFCALLDIHRPD
LIDYDALDKSDHRGNMQLAFDIAHAEIGIPKLLDVEDVCDVAKPDERSLMTYIAYWFHAF
SQMEKVENAGRRVEKFFNNMQGAWEMQSAYERRMAALLKAIREQVVSWKGSTFDGTYADA
KAQAFQFASYKKGKKREWVAEKSDLATLLGNIKTKLATYRLRPYDPPAHLRMEVLDDEWG
NLSKAEMSRGQLINETIRDIKDALRKSFADKANDFALALNTMQLAISGLEGDVEDQLHHV
RKLSENLPPLDAYLKTIEAVDLKCQEANIEENDFTTYSYDELCYELSLVKSSVSKKLAFL
ENQMVARNMTNLTPIQLEEFESVFRHFDRDDTNSLSELEFSAALASLGLVFSEDEMHEYF
LSTSNGRDRVTFEQFIRFMVDVTEDQNTAEQVFQSFREVADGKPYVTEMDLRHSLVPDEV
IEKLIEIIPKHTGPDMQSDRGMEQYDYIAFMEKLISEQEGRAASASSRRSSRASGVAGGG
GAAAPGQMPNHSHSASVGGSISHSRHNSHASIGGKSVLGGGDSRSNGLMMSPKSPGTPGT
NKPNGYH
Download sequence
Identical sequences Q7RYY6
5141.NCU06429.1 NCU06429T0 XP_957320.1.24337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]