SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5141.NCU09237.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5141.NCU09237.1
Domain Number 1 Region: 402-480
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.33e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.00035
Further Details:      
 
Domain Number 2 Region: 205-280
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000013
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 3 Region: 119-198
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000137
Family Eukaryotic type KH-domain (KH-domain type I) 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5141.NCU09237.1
Sequence length 489
Comment (Neurospora crassa)
Sequence
MSASPQPTQSAKRPLDESSSPSRNDQPEAKRLALDKVVKDAQEEVEAPVPEDSHNADETA
GSATPTPAPESNGTKVKGDKSEGQDAQGDTVVPDAPQSKATKDHGARSRAQPPVSAQPHD
ETAWIHVRSVISSPEAATIIGKGGENVSKIREMSNAKCTVSDYQKGAVERILTVSGVVDA
VAKAFGLIIRTLNNEPLAEPSNTHSKTYPLRLLIPHVLIGSIIGKGGARIKEIQEASGAR
LNASDSCLPLSTERSLVVMGVADAVHIATYYVGSTLLEQLNERFGGPAASAYATRSGGPA
ASIPGGLQVVPYVPQPAGGNFGNRDYYQRNRGPDPRSHHGMPPSQYPAPYGAPHPAQPNP
AVPMHYGAHAAGGYGAAAPHVAPHVGHAGPAPHAAGPHGAPVAGAALTQQIYIPNDMVGA
IIGKGGQKINEIRQISGSVIKINEPQDNSNERLVTITGTEECNRMALYLLYQRLGELQNN
GRDSQQPNH
Download sequence
Identical sequences Q6MVL4
5141.NCU09237.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]